Protein Info for GFF2018 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 7 to 640 (634 residues), 872.5 bits, see alignment E=7.7e-267 PF12831: FAD_oxidored" amino acids 8 to 160 (153 residues), 34.2 bits, see alignment E=4.7e-12 PF01134: GIDA" amino acids 8 to 407 (400 residues), 561.6 bits, see alignment E=2.6e-172 PF21680: GIDA_C_1st" amino acids 469 to 575 (107 residues), 78.4 bits, see alignment E=1.4e-25 PF13932: SAM_GIDA_C" amino acids 577 to 641 (65 residues), 89.6 bits, see alignment E=2.9e-29

Best Hits

Swiss-Prot: 88% identical to MNMG_ACIAC: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 88% identity to aaa:Acav_0061)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (655 amino acids)

>GFF2018 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLYPQEFDVIVVGGGHAGTEAALAAARMGCATLLLTHNIETLGQMSCNPSIGGIGKGHLV
KEVDALGGAMALATDEGGIQFRILNSSKGPAVRATRAQADRVLYKAAIRRTLENQPNLWL
FQQAVDDLMVEGDRVTGAVTQVGIRFRGRTVVLTAGTFLDGKIHVGLNNYAAGRAGDPPA
VSLSARLKELQLPQGRLKTGTPPRLDGRSIDYSKCTEQPGDGVPGGMNADRPVPVFSFMG
STAMHPQQVPCWITHTNERTHDIIRSGFDRSPMFTGKIEGVGPRYCPSVEDKINRFADKD
SHQIFLEPEGLTTHEVYPNGISTSLPFDIQYALVRSMPGLENAHILRPGYAIEYDYFDPR
SLKNSFETKQIQGLFFAGQINGTTGYEEAAAQGLFAGLNAALQCRGESAWLPRRDEAYLG
VLVDDLVTQGVTEPYRMFTSRAEFRLQLREDNADMRLTEAGRRLGLVGDAQWDAFCRKRD
AVSRETERLKATWVNPRNLPAQEGERVLGKAIEHEHNLFDLLRRPGVAYVDLVGMDGGKY
VAPEVSRETLAELLEPVVEQLEIAAKYSGYIDRQKNEVERAAHYEGLKLPPDLDYLQVTA
LSFEARQKLAKHRPETLGQASRISGITPASISLLLIHLKKGGFKGFATLPADAAA