Protein Info for GFF2015 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Chromosome (plasmid) partitioning protein ParA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF06564: CBP_BcsQ" amino acids 3 to 149 (147 residues), 42 bits, see alignment E=2.9e-14 PF10609: ParA" amino acids 3 to 44 (42 residues), 34.5 bits, see alignment 5.3e-12 PF13614: AAA_31" amino acids 3 to 178 (176 residues), 216.1 bits, see alignment E=1.2e-67 PF09140: MipZ" amino acids 4 to 155 (152 residues), 52.5 bits, see alignment E=1.6e-17 PF01656: CbiA" amino acids 6 to 228 (223 residues), 97.5 bits, see alignment E=2e-31 PF00142: Fer4_NifH" amino acids 10 to 47 (38 residues), 31.1 bits, see alignment 6.2e-11 PF02374: ArsA_ATPase" amino acids 10 to 42 (33 residues), 25.7 bits, see alignment 2.3e-09

Best Hits

Swiss-Prot: 61% identical to Y002_PSEPK: Uncharacterized protein PP_0002 (PP_0002) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 88% identity to adk:Alide2_0057)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF2015 Chromosome (plasmid) partitioning protein ParA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAKIFCVANQKGGVGKTTTTVNLAAGLAKVGQRVLMVDLDPQGNATMGSGVDKRQMALSV
YDVLLESASVAEAAVYSEKCGYHVLGANRELAGAEVELVEVERREKRLKTALAEVGDTYD
FVLIDCPPSLSMLTLNGLCAAHGVIVPMQCEYFALEGLTDLVNTIKQVHANLNKDLAIIG
LLRVMFDPRITLQQQVSDQLKAHFGDKVFDTVIPRNVRLAEAPSYGLPGVVFDPAARGSQ
AFVAFAQEMVARIGKM