Protein Info for GFF2014 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: C4-dicarboxylate transporter DcuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 6 to 37 (32 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 87 to 112 (26 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 164 to 190 (27 residues), see Phobius details amino acids 226 to 243 (18 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details amino acids 410 to 431 (22 residues), see Phobius details TIGR00770: transporter, anaerobic C4-dicarboxylate uptake (Dcu) family" amino acids 5 to 433 (429 residues), 678.6 bits, see alignment E=2.1e-208 PF03605: DcuA_DcuB" amino acids 5 to 365 (361 residues), 493.4 bits, see alignment E=3.9e-152 PF03600: CitMHS" amino acids 32 to 284 (253 residues), 34.8 bits, see alignment E=1e-12

Best Hits

Swiss-Prot: 95% identical to DCUA_ECO57: Anaerobic C4-dicarboxylate transporter DcuA (dcuA) from Escherichia coli O157:H7

KEGG orthology group: K07791, anaerobic C4-dicarboxylate transporter DcuA (inferred from 99% identity to ses:SARI_03307)

MetaCyc: 95% identical to C4-dicarboxylate transporter DcuA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-106; TRANS-RXN-106A; TRANS-RXN-106B; TRANS-RXN-299; TRANS-RXN-379

Predicted SEED Role

"C4-dicarboxylate transporter DcuA"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>GFF2014 C4-dicarboxylate transporter DcuA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIVVELIIVLLAIFLGARLGGIGIGFAGGLGVLVLAAIGVKPGTIPFDVISIIMAVIAAI
SAMQVAGGLDYLVNQTEKLLRKNPKYITILAPIVTYFLTIFAGTGNISLATLPVIAEVAK
EQGIKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGISYIHLLSVVIPSTLLAVL
VMSFLVTMLFNSKLSDDPIYRKRLEEGLIELRGEKQIEIKPMAKNSVWLFLLGVICVVVY
AIVNSPSLGLVEKPLMNTTNAILIIMLSVATLTTILCKVETDAILNSSTFKAGMSACICI
LGVAWLGDTFVSANIDWIKDTAGSVIQGHPWLLAVIFFFASALLYSQAATAKALMPMALA
LNVSPLTAVASFAAVSGLFILPTYPTLVAAVQMDDTGTTRIGKFVFNHPFFIPGTLGVVL
AVCFGFLLGSFML