Protein Info for GFF2012 in Variovorax sp. SCN45

Annotation: Putative transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 156 to 181 (26 residues), see Phobius details PF13548: DUF4126" amino acids 11 to 183 (173 residues), 194.3 bits, see alignment E=7.3e-62

Best Hits

KEGG orthology group: None (inferred from 97% identity to vpe:Varpa_5356)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>GFF2012 Putative transmembrane protein (Variovorax sp. SCN45)
MNTGLDMPQLIALAAAIGWASGVRLYLVVLLTGIVGYFGWVPLPSGLQLLAHPVVIAASG
FMVFIEFFADKIPGLDSLWDVVHTAIRIPAGAALAASVFGADHGVMAIVAALLGGGFAAT
AHAAKATTRAAINTSPEPFSNVGASLVEDSMVPAGLWLAVAHPVVFLVLFVLVLVLSVWL
IRKSWRFLKALFARVARIFSGRPDPGVVPAFQLKKNPPGDTPNV