Protein Info for GFF201 in Variovorax sp. SCN45

Annotation: Probable ferredoxin oxidoreductase oxidoreductase protein (EC 1.-.-.- )

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF00111: Fer2" amino acids 4 to 77 (74 residues), 62.2 bits, see alignment E=5.5e-21 PF00970: FAD_binding_6" amino acids 101 to 190 (90 residues), 48.3 bits, see alignment E=1.6e-16 PF00175: NAD_binding_1" amino acids 204 to 306 (103 residues), 61.9 bits, see alignment E=1.3e-20

Best Hits

Swiss-Prot: 61% identical to NAGAA_RALSP: Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin--NAD(P)(+), reductase component (nagAa) from Ralstonia sp.

KEGG orthology group: K14581, naphthalene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component [EC: 1.18.1.3] (inferred from 94% identity to vpe:Varpa_2932)

MetaCyc: 61% identical to 2,4-dinitrotoluene dioxygenase complex ferredoxin reductase component (Burkholderia sp. DNT)
RXN-8820 [EC: 1.14.12.24]

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.1.3

Use Curated BLAST to search for 1.14.12.24 or 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>GFF201 Probable ferredoxin oxidoreductase oxidoreductase protein (EC 1.-.-.- ) (Variovorax sp. SCN45)
MDLHIHPIARTLEVRPGANLLEVLREHHVPVSYSCMSGRCGTCRCKVVSGQVLDGGQDAI
RPDGQGERYVLACQSTLTESCAIEIPEPDEVVVHPARILKATVTGIDELTHDIRRLRLKP
NKPLEFSPGQYAQLQFAPDLARPYSMAGLSRDAELEFHVRRVPGGRVTAHIFEQLRVGDS
VRVSGPLGTAYLRTKHRGPMLCAAGGTGLAPILSIVRGAIATGLTQPIHLYLGVRSDADV
YGLHELRELQALHPGLNVHVVVVTGPANGSRRVGLITDAIRADWPGSLDGWRAYLCGSPP
MVEAVTQLVRGRGLAPEQTHADAFYLQGT