Protein Info for GFF2004 in Methylophilus sp. DMC18

Annotation: IS3 family transposase ISPa78

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF13276: HTH_21" amino acids 26 to 83 (58 residues), 62.1 bits, see alignment E=9.7e-21 PF00665: rve" amino acids 108 to 206 (99 residues), 95.7 bits, see alignment E=3.5e-31 PF13683: rve_3" amino acids 194 to 261 (68 residues), 40.2 bits, see alignment E=4.5e-14 PF13333: rve_2" amino acids 213 to 266 (54 residues), 46.5 bits, see alignment E=6.7e-16

Best Hits

KEGG orthology group: K07497, putative transposase (inferred from 61% identity to mlo:mlr6150)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>GFF2004 IS3 family transposase ISPa78 (Methylophilus sp. DMC18)
MCRVLDVSHSGFYVWRLRKQSQRERHNQILKAQIKDSFHGSDRTYGCPRIWLDLQAWGQV
CSENKVARLMQSLGLKARTKRRRQPGDLGVRNVHMLAPNLLQRQFSATAPNQSSVSDFTY
VWTVEGWLSVAAVLDLYSRRIVGWSMSQNMTAQLVMDALMMAIWRRGKPVSLMHHSDQGS
KYASEDFQRMLAAHGITCSMSRKGDCWDNAAMESFFSTLKLERVYRRRYLTREEARADIF
DYIERFYNPKMRHSTLSGMSPVAFEERYSSLTQCP