Protein Info for PS417_01015 in Pseudomonas simiae WCS417

Annotation: polar amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 67 to 99 (33 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 109 (98 residues), 89.3 bits, see alignment E=9.6e-30 PF00528: BPD_transp_1" amino acids 36 to 214 (179 residues), 69.8 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 35% identical to PATM_VIBHA: Probable amino-acid ABC transporter permease protein PatM (patM) from Vibrio harveyi

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 99% identity to pfs:PFLU0227)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVB3 at UniProt or InterPro

Protein Sequence (221 amino acids)

>PS417_01015 polar amino acid ABC transporter permease (Pseudomonas simiae WCS417)
MTFDFAFILSTLPAFLKAVGVTLQVGLIAIATSLLVALINAALLVFRTPYLSRLVALYVE
LARNTPLLIQLFFVYFALPALGFNISGFWAAIITLTFLGGAYLTEVLRAGVEAVPLAQVE
SGKSIGLSDWQLLRHVILPQAGILSLPALFANFIFLLKETTVVSAVAVPEILYTTKSYIA
LYYKTYEMLAVLTLICVLLFLPLSLLLSRLERRLQHGQFGS