Protein Info for GFF2 in Variovorax sp. SCN45

Annotation: Transcription accessory protein (S1 RNA-binding domain)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 791 PF09371: Tex_N" amino acids 3 to 76 (74 residues), 101.7 bits, see alignment E=5e-33 PF22706: Tex_central_region" amino acids 131 to 320 (190 residues), 197.3 bits, see alignment E=7.6e-62 PF16921: Tex_YqgF" amino acids 336 to 471 (136 residues), 168.2 bits, see alignment E=3.7e-53 PF14635: HHH_7" amino acids 484 to 576 (93 residues), 28.4 bits, see alignment E=6.4e-10 PF12836: HHH_3" amino acids 511 to 575 (65 residues), 92.2 bits, see alignment E=6e-30 PF17674: HHH_9" amino acids 581 to 650 (70 residues), 79.9 bits, see alignment E=7.2e-26 PF00575: S1" amino acids 668 to 740 (73 residues), 74.4 bits, see alignment E=2.7e-24

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 96% identity to vap:Vapar_2875)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (791 amino acids)

>GFF2 Transcription accessory protein (S1 RNA-binding domain) (Variovorax sp. SCN45)
MQKIIRQLAAEIKVGENQVKAAVELLDGGATVPFIARYRKEATDGLDDTQLRELEARLSY
LRELEDRRVAVLKAIDEQGKLTPELRAAIEFAPTKQELEDIYLPFKQKRRTKGQIAREFG
IEPLADKLLADPTLDPAVEAKAFLQPATTLDDGKPGPDFSTVPLVLDGVRDILSERWAED
AALVQSLRVWLWNEGLLKSSLMSGKDENNADVAKFRDYFEYDEPIGRVPSHRALAVFRGR
ALDILDAKLVLPVEPEPGKPSVAEGRIALHLGWSHAGRPADDLLRKCVAWTWRVKLALST
ERDLFTRLREDAEKVAIKVFADNLRDLLLAAPAGPRVVMGLDPGIRTGVKVAVVDSTGKL
VETATVFPHEPRKDWEGSLHTLGKLCAKHGVNLIAIGNGTASRETDKLAADLIKLLAKMA
AQAGAPEIQVDKVVVSEAGASVYSASEFASQEMPDVDVSLRGAASIARRLQDPLAELVKI
DPKSIGVGQYQHDVNQSELARTLQAVVEDCVNSVGVDLNTASVPLLSRVSGLSASVAKAV
VRWRESNGAFATRKQLLDVTGFGPKAFEQSAGFLRIRGGTDPLDVTGVHPETYPLVEQII
VKTGKPIAELMGRAEMLKTLKPELFANEKFGVITVKDILGELEKPGRDPRPDFKVARFND
GVDDIADLKEGMILEGTVSNVAQFGAFVDLGVHQDGLVHVSQLSHKFVNDAREVVKTGDI
VKVKVMEVDVARKRIGLSMKLDAAPARRDGPRDNRFEGAGRGQQQQGRRDNSPQPAGQMA
SAFAKLQGLRK