Protein Info for GFF1998 in Variovorax sp. SCN45

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 transmembrane" amino acids 57 to 80 (24 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details PF00512: HisKA" amino acids 242 to 304 (63 residues), 30.7 bits, see alignment E=3.9e-11 PF02518: HATPase_c" amino acids 349 to 458 (110 residues), 83.9 bits, see alignment E=1.7e-27 PF00072: Response_reg" amino acids 482 to 589 (108 residues), 49.7 bits, see alignment E=6e-17

Best Hits

KEGG orthology group: None (inferred from 84% identity to vpe:Varpa_5367)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (595 amino acids)

>GFF1998 Two-component system sensor histidine kinase (Variovorax sp. SCN45)
MPPTLPSGTESPSRPLLQRLRDYWVEAPNANPLVDQSLARAYVVDTRDTPLSAAVTAAVF
WILFLVLTGDRGTLVWAVLVHAMQWNMHRHLHRLDPAAIDAASAARTRRRLELRMLFPGL
VWSLAPWLFFPHGDLAYILLMYFFVSGATSVIIAALAQWWLAALCFGVPVFLSLALRLVL
EPGSVTVIMGCLAVSQLVAALHYARKQNRLIVGSIENGFENARLAEALRRQLEHVAQLAA
QRARIFAAANHDLRQPMHALAIFVDVLDTRSPPTAENLRFMRDSVDALRGSIDALLDIAQ
LDGGVAPVRLEPLPLQPLFDALHGRFAALAAAKGLRLRVRATRAVVRADARMLARLLGNL
VDNAIKYTPSGTVLVCARRAGRGRWRIEVRDSGVGIDARHQAQVFEEFFQVDNPGRDRSR
GLGLGLSLVASVARVMGSRIEVRTAPGRGSTFSLVLDEMAAPRGVAEMPMPSEPEPAGAI
RILVLDDEQPVREAMRSLLSAWGHEVVLAANPREALQQAGVFDLMLSDLRLGSGLSGLAA
AQALQAVGKARNVVILTGETAHANRAEVERAGYALIYKPADARALREAIADSLPA