Protein Info for GFF199 in Methylophilus sp. DMC18

Annotation: Nitrite reductase (NADH) small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00355: Rieske
  • amino acids 17 to 98 (82 residues), 27.9 bits, E=1.8e-10
• TIGR02378: nitrite reductase [NAD(P)H], small subunit
  • amino acids 17 to 119 (103 residues), 129.1 bits, E=3.5e-42
• PF13806: Rieske_2
  • amino acids 17 to 119 (103 residues), 142.6 bits, E=3.8e-46

Best Hits

Swiss-Prot: 46% identical to NIRD_SALTI: Nitrite reductase (NADH) small subunit (nirD) from Salmonella typhi

KEGG orthology group: K00363, nitrite reductase (NAD(P)H) small subunit [EC: 1.7.1.4] (inferred from 76% identity to mfa:Mfla_0318)

Predicted SEED Role

"Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

• alkylnitronates degradation (1/2 steps found)
• nitrate reduction V (assimilatory) (1/2 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.7.1.4

Protein Sequence (120 amino acids)

>GFF199 Nitrite reductase (NADH) small subunit (Methylophilus sp. DMC18)
MNQLQATNAQPAEAGAWHPVCALEDIWPNMGVCALIEGQQIAIFRLKDDQLYALDNHDPH
SEANVLSRGLVGDLGGEPVVASPIYKHHYQLRTGLCLEDATVCLNVYPVEVRDGKIWVQR