Protein Info for GFF1989 in Xanthobacter sp. DMC5

Annotation: Adaptive-response sensory-kinase SasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 924 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 289 to 314 (26 residues), see Phobius details amino acids 335 to 364 (30 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details amino acids 414 to 437 (24 residues), see Phobius details amino acids 447 to 466 (20 residues), see Phobius details amino acids 507 to 525 (19 residues), see Phobius details PF00512: HisKA" amino acids 682 to 748 (67 residues), 67.6 bits, see alignment 7.8e-23 PF02518: HATPase_c" amino acids 795 to 905 (111 residues), 103.7 bits, see alignment E=7.9e-34

Best Hits

KEGG orthology group: None (inferred from 80% identity to xau:Xaut_2428)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (924 amino acids)

>GFF1989 Adaptive-response sensory-kinase SasA (Xanthobacter sp. DMC5)
MGPALSPALVIGVAALYLAALFAIAAFADRRAREGRSLIGNAWVYGLSLAVYCTAWTYFG
SVGRAATTGVWFLPIYLGPTLVMLVAWVVVRKMIRIAHTYRITSIADFIASRYGKSPLVA
AVVTLITVVGIVPYIALQLKAVSAGYTVLTATGAQAAAPSWWQDGTLLVALALALFTILF
GTRHLDSAERHEGMVAAVAAESLVKLVAFLAVGAFVTYGLFGGFADVWARASALPGVKGL
LTLSGAGNFAWAQWFSLTLLSGLSVLLLPRQFQMMVVECVDERHLKRAAWVFPAYLLAIN
IFVLPLALGGLVLLGKGADPETFVLTLPLAHGAGGLALIAYVGGLSAATGMLIVETIAVS
TMVCNDLVMPALLRLKLIRADGGDLTRLLLNIRRAAILGVLLLGYLYFVVAGEAYALVSI
GLISFAAVAQFAPALLGGMYWRGATRLGALGGLLGGFAVWAYTLMLPSVAKSGWMDAAFL
THGPFGIAALAPERLFGLSGLDNLSHALFWSLFVNGVLYVGLSLWRAPSGREASQALLFV
DVFARGRSAADPVFWRGRAHRADLEALARRLLGADTARQIFEDHARDSGTGDVADLTADA
RLVDIVERRIAGAVGAASARVLVAAVADEEPLNAGDVMDILNEASQLRVYARALEEKSRS
LEIASAELSAANAQLRTLDELKDDFMSSVTHELRTPLTAIRALSELMLDTPDMEAEQRQD
FLRIIVGESERLGRLVNQVLDMAKIESGHAEWHSTDVDLKALVADAVKATAELARTKGAE
IVLTAPASVPSVKADPDRLTQVMLNLISNAAKFVPAQGGRIDVRLLADADGLEVQVEDNG
PGVPPADRDTIFEKFRQGGDALNRPPGTGLGLPISRRIVDHFGGKIWLDQKAGKGACFAF
RLPLRSQGANAPTQTTSAEAEETT