Protein Info for GFF1987 in Sphingobium sp. HT1-2

Annotation: Type II restriction adenine-specific methylase (EC 2.1.1.72)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF01555: N6_N4_Mtase" amino acids 50 to 271 (222 residues), 225.6 bits, see alignment E=7.8e-71 PF18755: RAMA" amino acids 281 to 379 (99 residues), 69.7 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 63% identical to MTS1_RHIME: Modification methylase SmeI (smeIM) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K13581, modification methylase [EC: 2.1.1.72] (inferred from 89% identity to sch:Sphch_1451)

Predicted SEED Role

"Modification methylase"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>GFF1987 Type II restriction adenine-specific methylase (EC 2.1.1.72) (Sphingobium sp. HT1-2)
MGVAHMGVMERVAPRRKKAVALAPAPAIEANRLLRGDCIAEMAKLPDGCIDMIFADPPYN
LQLGGDLFRPEGGRVDAVDNDWDKFDTLSSYDRFTKAWLAQARRILKPNGTIWVIGSYHN
IFRVGAALQDEGFWILNDIIWRKANPMPNFKGTRFTNAHETLIWASQGEDAKYTFNYKAM
KTLNDELQMRSDWVLPICGGQERLKRNGTKAHPTQKPESLLYRVMLSCTKPGDIVLDPFF
GTGTTGAVAKRLGRQWIGIEREPDYIEVAEERIAEALPLDESALAIMQTARQQPKVAFGT
LVETGYLQPGSVVMDSKRRWSATVRADGSLAVGSDTGSIHKLGATLQGAPSCNGWTFWHI
EKAGKLHPIDTLRQTYLLANEP