Protein Info for GFF1986 in Variovorax sp. SCN45

Annotation: Oxidoreductase, short-chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00106: adh_short" amino acids 13 to 206 (194 residues), 165.4 bits, see alignment E=1.8e-52 PF08659: KR" amino acids 13 to 166 (154 residues), 37.6 bits, see alignment E=3.4e-13 PF13561: adh_short_C2" amino acids 21 to 253 (233 residues), 180.7 bits, see alignment E=5.3e-57

Best Hits

Swiss-Prot: 32% identical to TRNH4_ARATH: Tropinone reductase homolog At2g29170 (At2g29170) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 98% identity to vpe:Varpa_5380)

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.125

Use Curated BLAST to search for 1.1.1.125

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF1986 Oxidoreductase, short-chain dehydrogenase/reductase family (Variovorax sp. SCN45)
MDTTQLFSLKGRTALITGGSRGIGRMIAEGFLAQGARVYISARKAAACDQTAKELSAFGH
CVSLPADVSTVEGAQKLVEAYAKHEGSLDILVNNAGAAWGAPYAEFPESGWDKVVDLNLK
TPFFLTQALTPMLKKAATDHLAKVINIASIDGISVNPQETYSYAASKAGLIQLTRRMALR
LAQERIVVSAIAPGAFASDMNKDARDHGDEVKGRIPAGRIGVPEDMAGAAIYLASRAGDY
VMGSTLVVDGGVTHAR