Protein Info for GFF1983 in Variovorax sp. SCN45

Annotation: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (EC 3.1.3.82); Histidinol-phosphatase (EC 3.1.3.15)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 TIGR01662: HAD hydrolase, family IIIA" amino acids 2 to 141 (140 residues), 103.8 bits, see alignment E=8.1e-34 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 3 to 143 (141 residues), 129.6 bits, see alignment E=8.7e-42 PF08645: PNK3P" amino acids 18 to 113 (96 residues), 29.6 bits, see alignment E=8.2e-11 PF00702: Hydrolase" amino acids 19 to 138 (120 residues), 30.6 bits, see alignment E=6.5e-11 PF13242: Hydrolase_like" amino acids 99 to 153 (55 residues), 28.4 bits, see alignment E=1.9e-10

Best Hits

Swiss-Prot: 56% identical to GMHBB_BORBR: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (BB4091) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 94% identity to vpe:Varpa_5390)

Predicted SEED Role

"Histidinol-phosphatase (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-, 3.1.3.15

Use Curated BLAST to search for 3.1.3.- or 3.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>GFF1983 D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (EC 3.1.3.82); Histidinol-phosphatase (EC 3.1.3.15) (Variovorax sp. SCN45)
MKLVILDRNGTINVHREDFVKSDIEWTPLPGALEAVARLNHAGWHVVIASNQSGLGRGLF
DMASLNAMHAKMHKMLAAVGGRIDAVFYCPHSPDEDCDCRKPKPGLFLQIGDRYGIDLKG
IPTAGDSLRDLQAGAAAGCEPHLLLTGMGAACRGVDPLPSEYPANTVVHTDLAAFVDFLL
AREARAALQVTV