Protein Info for GFF1980 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 12 to 246 (235 residues), 104.1 bits, E=2.6e-33
• PF00975: Thioesterase
  • amino acids 13 to 129 (117 residues), 38.9 bits, E=2.9e-13
• PF12146: Hydrolase_4
  • amino acids 13 to 244 (232 residues), 77.5 bits, E=2.5e-25
• PF12697: Abhydrolase_6
  • amino acids 14 to 249 (236 residues), 89.9 bits, E=9.5e-29

Best Hits

KEGG orthology group: None (inferred from 56% identity to aaa:Acav_0161)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• superpathway of salicylate degradation (6/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (5/6 steps found)
• aromatic compounds degradation via β-ketoadipate (7/9 steps found)
• catechol degradation to β-ketoadipate (3/4 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (3/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (6/11 steps found)
• 4-methylcatechol degradation (ortho cleavage) (3/7 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (17/35 steps found)
• superpathway of aerobic toluene degradation (10/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Protein Sequence (264 amino acids)

>GFF1980 Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MIPKFTTLGSGPTVLMLHGIGGGHIAFAPQVETLAAAGYRAVAWDMPGYGHSAPIEPYTF
KGLAQSCIDLIDALQCEHVVLLGHSMGGMVAQEVVARRPERVSRLVLCGTSAAFGKRTDG
RSADAWAQQFIAQRTAPLDAGQSMAEVAGRLVPQMVGPGSLPEGLRLAEHCMAGVPAATY
RRALDCLVTFDRQAALGSIGVPTLLIGGEFDRVAAPAVMKQMAEAIPDARYAELKGIGHL
MNLEAPDDFDALLLDFLAQTRALH