Protein Info for GFF1978 in Methylophilus sp. DMC18

Annotation: Dibenzothiophene desulfurization enzyme C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 TIGR04022: sulfur acquisition oxidoreductase, SfnB family" amino acids 20 to 409 (390 residues), 642.7 bits, see alignment E=9.6e-198 PF02771: Acyl-CoA_dh_N" amino acids 31 to 131 (101 residues), 45.3 bits, see alignment E=2.1e-15 PF02770: Acyl-CoA_dh_M" amino acids 147 to 225 (79 residues), 37.1 bits, see alignment E=5.9e-13 PF08028: Acyl-CoA_dh_2" amino acids 252 to 385 (134 residues), 77.4 bits, see alignment E=2.7e-25 PF00441: Acyl-CoA_dh_1" amino acids 255 to 382 (128 residues), 34.8 bits, see alignment E=3.7e-12

Best Hits

KEGG orthology group: None (inferred from 86% identity to mei:Msip34_1949)

Predicted SEED Role

"Acyl-CoA dehydrogenase; probable dibenzothiophene desulfurization enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>GFF1978 Dibenzothiophene desulfurization enzyme C (Methylophilus sp. DMC18)
MTAQANKIAHLPVNLPRQAAHLIKSDAEALTVAKQVASEIAKEAALRDQERRLPRKELDL
FSSSGLWGITVPKEYGGAFVSNKTLAEVVATVAEADPSVGQIPQNHLYMVEGLRLDGSDF
QKKYFFELVLQGVRFGNAFSEIGTKSVNDVKTKLTPTNSGYFLNGKKFYSSGALLADWVP
VVAKDEHDNTVVAFVPAGAEGLTIIDDWSSFGQRTTASGTTILENIFVPSEYVLPHHLAF
DRPTTMGPIAQIIQAAVDTGIARAAFKDTLHFVRNYTRPWIDTDLEHGYEDPHTIKDIGD
LQIRLHATEALLARAGEYIDEAQRNPNEDTVAEASIAVAEAKVLSTETALLAGSKLFELA
GTRSTLGEYNLDRHWRNARTHTLHDPVRWKYHAVGNYSLNKVKPPRHPWI