Protein Info for GFF1973 in Variovorax sp. SCN45

Annotation: NAD(P)H oxidoreductase YrkL @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 75 to 94 (20 residues), see Phobius details PF02525: Flavodoxin_2" amino acids 1 to 139 (139 residues), 100 bits, see alignment E=1.5e-32 PF03358: FMN_red" amino acids 1 to 109 (109 residues), 43.6 bits, see alignment E=2.3e-15

Best Hits

KEGG orthology group: None (inferred from 96% identity to vpe:Varpa_5412)

Predicted SEED Role

"NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2" (EC 1.6.99.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.-

Use Curated BLAST to search for 1.6.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>GFF1973 NAD(P)H oxidoreductase YrkL @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2 (Variovorax sp. SCN45)
MRVLVVYCHPVETSFHAALHQEVLKNLRAAGHEVDDCDLYAEGFNPVLSREERLGYHDVP
SNRLPLAPYVERLQWAEGIVFCFPTWCFGLPAMLKGYFDRLFMPGVAFDISDPANVKPML
THIKRISAVVTYGRPRWMAMYMGDPPRKIVTRYMKRLTGQRARVDYHAHYHMNIATEPQL
KRFMARVGQAMARFA