Protein Info for GFF1973 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 57 to 77 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 220 to 245 (26 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details amino acids 348 to 377 (30 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details PF00654: Voltage_CLC" amino acids 68 to 393 (326 residues), 80.6 bits, see alignment E=6.5e-27

Best Hits

Swiss-Prot: 100% identical to YFEO_SALTY: Putative ion-transport protein YfeO (yfeO) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to seg:SG2440)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>GFF1973 Chloride channel protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFHPRARTMLLLSLPALIIGVASSLVLIAAMKVASVFQQFLWQRLPTSIGIAYDSPFWIV
GMLTLTGIVVGLIIRYSPGHAGPDPAIEPLISMPVSPSALPGLLLALIIGLAGGVSLGPE
HPIMTINIALAAAFGSRLFPRITALDWTILASAGTIGALFGTPVAAALIFSQTLSGSNDI
PMWDRLFAPLMAAAAGSLTTSLFFHPHFSLPIAHYTQMRLVDIASGAIVAAIAIAAGMVA
VWCLPRLHELLHRLKNPVLILGIGGFILGILGVIGGPLTLFKGLDEMQQMAFSQTLGAGD
YFTLAVVKLAALVIAAASGFRGGRIFPAVFIGAALGLMLHAHVEAVPAAITVSCAILGLV
LVVTRDGWLSLFMAAVVVPDTNLLPLLCIVMLPAWLLLAGKPLLAANRHEP