Protein Info for GFF1965 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phosphoglycerate transporter protein PgtP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 117 to 145 (29 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 328 to 344 (17 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details amino acids 415 to 436 (22 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 402 (369 residues), 175.8 bits, see alignment E=5.9e-56 TIGR00881: phosphoglycerate transporter family protein" amino acids 35 to 419 (385 residues), 500.6 bits, see alignment E=1.4e-154

Best Hits

Swiss-Prot: 100% identical to PGTP_SALTY: Phosphoglycerate transporter protein (pgtP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11382, MFS transporter, OPA family, phosphoglycerate transporter protein (inferred from 99% identity to spt:SPA0461)

Predicted SEED Role

"Phosphoglycerate transporter protein PgtP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>GFF1965 Phosphoglycerate transporter protein PgtP (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLTILKTGQSAHKVPPEKVQATYGRYRIQALLSVFLGYLAYYIVRNNFTLSTPYLKEQLD
LSATQIGLLSSCMLIAYGISKGVMSSLADKASPKVFMACGLVLCAIVNVGLGFSSAFWIF
AALVVFNGLFQGMGVGPSFITIANWFPRRERGRVGAFWNISHNVGGGIVAPIVGAAFAIL
GSEHWQSASYIVPACVAVIFALIVLVLGKGSPRKEGLPSLEQMMPEEKVVLKTKNTAKAP
ENMSAWQIFCTYVLRNKNAWYISLVDVFVYMVRFGMISWLPIYLLTVKHFSKEQMSVAFL
FFEWAAIPSTLLAGWLSDKLFKGRRMPLAMICMALIFVCLIGYWKSESLLMVTIFAAIVG
CLIYVPQFLASVQTMEIVPSFAVGSAVGLRGFMSYIFGASLGTSLFGVMVDKLGWYGGFY
LLMGGIVCCILFCYLSHRGALELERQRQNALHNQDSLQLADAQ