Protein Info for GFF1963 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phosphoglycerate transport regulatory protein PgtC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF13531: SBP_bac_11" amino acids 36 to 274 (239 residues), 63.5 bits, see alignment E=5.1e-21 PF01547: SBP_bac_1" amino acids 43 to 269 (227 residues), 31.3 bits, see alignment E=4.6e-11 PF13343: SBP_bac_6" amino acids 70 to 295 (226 residues), 103.7 bits, see alignment E=2.4e-33 PF13416: SBP_bac_8" amino acids 82 to 292 (211 residues), 37.5 bits, see alignment E=4.9e-13

Best Hits

Swiss-Prot: 100% identical to PGTC_SALTY: Phosphoglycerate transport regulatory protein PgtC (pgtC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08478, phosphoglycerate transport regulatory protein PgtC (inferred from 99% identity to seh:SeHA_C2651)

Predicted SEED Role

"Phosphoglycerate transport regulatory protein PgtC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>GFF1963 Phosphoglycerate transport regulatory protein PgtC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VGAFTLWLAAMFGSCQAYSRELVMATTFSPSATAWIIQRWQTEPGSVMIRTLNRTSGSLE
QLLDTANAENVDLILTSSPMLLQHLQEHQKLALLDSAPAASQKLVPRSIRSTSVAVAVSG
FGLLINRSALAARHLPPPADWQDMGLPSYQGALLMSSPSRSDTNHLMVESLLQQKGWTAG
WATLLAISGNLVTISSRSFGVADKIKSGLGVAGPVIDNYANLLLNDPNLAFTYFPYSAVS
PTYVAVLKNSRHADEARAFIHYLLSPKGQRILADANTGKYPVAPLSADNPRAAQQQRLMA
QPPLNYRLILKRQQLVQRMFDTAISFRLAQLKDAWRALHSAETRLKRPLPEIRALLTSVP
VDAASSEDETWLAQFDNKSFAEQKMMEWQIWFLNNQRLAIHKLEELK