Protein Info for GFF1949 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sensory box histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 TIGR00229: PAS domain S-box protein" amino acids 26 to 148 (123 residues), 56.1 bits, see alignment E=2e-19 PF00989: PAS" amino acids 26 to 138 (113 residues), 47.6 bits, see alignment E=3.9e-16 PF08448: PAS_4" amino acids 30 to 143 (114 residues), 34.4 bits, see alignment E=5.7e-12 PF13426: PAS_9" amino acids 33 to 140 (108 residues), 51.7 bits, see alignment E=2.4e-17 PF07730: HisKA_3" amino acids 187 to 263 (77 residues), 38.5 bits, see alignment E=3.5e-13 PF02518: HATPase_c" amino acids 308 to 399 (92 residues), 47 bits, see alignment E=8.2e-16

Best Hits

KEGG orthology group: None (inferred from 68% identity to rfr:Rfer_3744)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>GFF1949 Sensory box histidine kinase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MHLDANHLVSRPEAPATGAWRDPLALLLASTGEGVFGVDLDGLCVFINHAGARMIGFEPA
ELLGANMHDLTHHSHADGAHYPVEDCPIFNAFRQGLPCRIDSEVFWRRDGTAFPVEYSSH
PIVDGGEVRGAVVTFVDITERKRAADALQRAKDQLEERVGERTLALATALKQVRELAARS
ETVREDERTRIAREVHDELGSLLVALKMDVNWMDKRLSEQEQRSAEAAHDMRDRMRCKCQ
NMSRLIETAVDNVGRIITDLRPSILDHQGLWAALEWQAQEFVQSAEMALDWRLDVAEAPE
PPEPLAMAVFRIFQEMLSNVGRHAHADQLAVHIVVQGTALQLCVQDNGVGAPPQAFEAAN
AYGVMGMRERARHFGGDIRIDSAPGRGTRMCLTVTLPLETEALT