Protein Info for GFF1948 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative membrane protein YfcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 7 to 40 (34 residues), see Phobius details amino acids 52 to 59 (8 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 163 to 180 (18 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details PF01925: TauE" amino acids 18 to 253 (236 residues), 169.4 bits, see alignment E=5.5e-54

Best Hits

Swiss-Prot: 91% identical to YFCA_ECO57: Probable membrane transporter protein YfcA (yfcA) from Escherichia coli O157:H7

KEGG orthology group: K07090, (no description) (inferred from 99% identity to ses:SARI_00518)

Predicted SEED Role

"Putative membrane protein YfcA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>GFF1948 Putative membrane protein YfcA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDNFYDLFMVSPLLLVVLFFVAVLAGFIDSIAGGGGLLTIPALMAAGMSPANALATNKLQ
ACGGSLSSSLYFIRRKVVNLAEQKLNILMTFIGSMSGALLVQHVQADILRQILPILVIFI
GLYFLLMPKLGEEDRQRRLYGLPFALIAGGCVGFYDGFFGPAAGSFYALAFVTLCGYNLA
KSTAHAKVLNATSNVGGLLLFIIGGKVIWATGFVMLVGQFLGARMGSRLVLSKGQKLIRP
MIVIVSAVMSARLLYDSHGQEILHWLGMN