Protein Info for GFF1947 in Sphingobium sp. HT1-2

Annotation: UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01133: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase" amino acids 5 to 359 (355 residues), 268.1 bits, see alignment E=5.6e-84 PF03033: Glyco_transf_28" amino acids 7 to 142 (136 residues), 99.8 bits, see alignment E=2.1e-32 PF13579: Glyco_trans_4_4" amino acids 21 to 170 (150 residues), 35.3 bits, see alignment E=2.2e-12 PF04101: Glyco_tran_28_C" amino acids 189 to 352 (164 residues), 126.6 bits, see alignment E=1.6e-40

Best Hits

Swiss-Prot: 67% identical to MURG_NOVAD: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K02563, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC: 2.4.1.227] (inferred from 93% identity to sch:Sphch_1423)

Predicted SEED Role

"UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.1.227)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>GFF1947 UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Sphingobium sp. HT1-2)
MSISRHFVLAAGGTGGHMIPAHAVAEELMARGHHVALVTDERGAKIPGIFDKAQVHVMPA
GRMTKNPASWPGALKAILAGRAMARRLNDTFKPTAVVGFGGYPAMPALLGALADGIPTAI
HEQNAVLGRVNRLLAGRVDAIATAYPLVERLKDKYAGKVHLVGNPVREEVKALRDEEFPA
LTDESVFRVLVIGGSQGASILSSVVPEGLSMLPIALRRRLQVTQQCRAEDIERVRATYAE
MEIPADLATYFNDVPEKLGWSHLMIARAGASTLAELTCAGRPAILVPLPSAMDDHQTANA
REMTEAGGARTIPQSRFTAVELAKQMQKMALEPGALQNAAKRARACGRPDAARDMADLLE
SIGPAPIMNDPLRVGPTPTTLNLQGVPA