Protein Info for GFF1946 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cyanate ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 103 to 122 (20 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 80 to 277 (198 residues), 220.3 bits, see alignment E=1e-69 PF00528: BPD_transp_1" amino acids 114 to 283 (170 residues), 75 bits, see alignment E=3.3e-25

Best Hits

Swiss-Prot: 44% identical to NRTB_SYNY3: Nitrate import permease protein NrtB (nrtB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 78% identity to rfr:Rfer_3741)

Predicted SEED Role

"Cyanate ABC transporter, permease protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>GFF1946 Cyanate ABC transporter, permease protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKQASLNLRAALVSLLLFAVFIGAWQLSTSGPSIGGSSAGMTAEEIEYAKMMGKDPGAAK
STGFPPPIEVAKSSWAQLSDPFYDKGPNDKGIGIQLAHSLARVGLGFVLAMAVAIPLGFL
IGMSPLMRKAFDPFVQVLKPISPLAWMPLALYTLKDSDVSGIFVIFICSVWPMLINTAFG
VASVKREWLNVASTLEVNPIRKAFQVILPAAAPTILTGMRISMGIAWLVIVAAEMLVGGT
GVGYFVWNEWNNLSLTNVIFAVLLIGVVGMLLDLMFAQLQKAVTYVE