Protein Info for GFF1941 in Sphingobium sp. HT1-2

Annotation: D-alanine--D-alanine ligase (EC 6.3.2.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR01205: D-alanine--D-alanine ligase" amino acids 7 to 306 (300 residues), 264.6 bits, see alignment E=5e-83 PF01820: Dala_Dala_lig_N" amino acids 55 to 87 (33 residues), 38.9 bits, see alignment 1.2e-13 PF07478: Dala_Dala_lig_C" amino acids 134 to 303 (170 residues), 136.7 bits, see alignment E=7.8e-44

Best Hits

Swiss-Prot: 82% identical to DDL_NOVAD: D-alanine--D-alanine ligase (ddl) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 87% identity to sjp:SJA_C1-27880)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.4

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>GFF1941 D-alanine--D-alanine ligase (EC 6.3.2.4) (Sphingobium sp. HT1-2)
MSRGPWHVAVLMGGWSAERPVSLSSGEGVAKALESRGHRVTRIDMDRDVAARLTETKADV
VFNALHGVPGEDGTVQGMMDLMGLTYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGQIV
ASESLYAGDPLPRPYVLKPVNEGSSVGVAIVTAEGNYGNPIARDSVGPWQEFPELLAEPY
IRGRELTTAVLGDEALLVTELRPKSGFYDFDAKYTDGMTEHVCPAEIPDEITQACKAIAL
QAHQLLGCKGASRSDFRWDDSQGVEGLYLLEVNTQPGMTPLSLVPEQAKKLGIEYAELVE
RICEEALTRGPNMGAGNG