Protein Info for GFF1940 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative DNA-binding protein in cluster with Type I restriction-modification system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13693: HTH_35
  • amino acids 7 to 73 (67 residues), 108.7 bits, E=1.8e-35
• PF01381: HTH_3
  • amino acids 13 to 63 (51 residues), 23.2 bits, E=8.9e-09
• PF13443: HTH_26
  • amino acids 13 to 64 (52 residues), 23.9 bits, E=6.3e-09

Best Hits

Swiss-Prot: 53% identical to NER_BPMU: Negative regulator of transcription (ner) from Escherichia phage Mu

KEGG orthology group: None (inferred from 96% identity to ses:SARI_00525)

Predicted SEED Role

"Putative DNA-binding protein in cluster with Type I restriction-modification system" in subsystem Restriction-Modification System

Protein Sequence (82 amino acids)

>GFF1940 Putative DNA-binding protein in cluster with Type I restriction-modification system (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MEPKSQDWHRADIKSALEKRGITLRDLSRQAGLSPDSLRNVFTRSWPRAERIIADALGIT
PKEIWPSRYDDMQIKNDADIAE