Protein Info for GFF1937 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 313 to 332 (20 residues), see Phobius details PF27202: Flk_N" amino acids 29 to 90 (62 residues), 98.5 bits, see alignment E=1.1e-32 amino acids 163 to 223 (61 residues), 75 bits, see alignment E=2.2e-25

Best Hits

Swiss-Prot: 100% identical to FLK_SALTY: Flagellar regulator flk (flk) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to seg:SG2401)

Predicted SEED Role

"Cell division protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF1937 Cell division protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MHPISGAPAQPPGEGRNPLSAASEQPLSMQQRTVLERLITRLISLTQQQSAEVWAGMKHD
LGIKNDAPLLSRHFPAAEQNLTQRLGVAQQNHANRQVLSQLTELLGVGNNRQAVSDFIRQ
QYGQTALSQLTPDQLKNVLTLLQQGQLSIPQPQQRPATDRPLLPAEHNTLNQLVTKLAAA
TGESNKLIWQSMLELSGVKSGELIPAKQFTHLATWLQARQTLSLQHAPTLHTLQAALKQP
LEPDELTAIKEYAQHTYQIQPQTVLTTAQVQDLLNHIFLRRVEREADELEPLSIQPIYRP
FAPMIETVKNLSARPGLLFIALIIVLALFWLVS