Protein Info for GFF1934 in Xanthobacter sp. DMC5

Annotation: Ribose-phosphate pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR01251: ribose-phosphate diphosphokinase" amino acids 8 to 317 (310 residues), 383.6 bits, see alignment E=2.8e-119 PF13793: Pribosyltran_N" amino acids 8 to 124 (117 residues), 175.4 bits, see alignment E=5.2e-56 PF00156: Pribosyltran" amino acids 160 to 273 (114 residues), 79.1 bits, see alignment E=3.6e-26 PF14572: Pribosyl_synth" amino acids 205 to 316 (112 residues), 84.4 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 82% identical to KPRS_BRADU: Ribose-phosphate pyrophosphokinase (prs) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 97% identity to xau:Xaut_2553)

MetaCyc: 53% identical to ribose-phosphate diphosphokinase (Escherichia coli K-12 substr. MG1655)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF1934 Ribose-phosphate pyrophosphokinase (Xanthobacter sp. DMC5)
MSAENGPMKLVAGNSNRALAEAIAAYLATPLTKAVVRRFADMEIFVEIQENVRGQDVFVV
QSTSFPTNDHLMELLIIIDALRRASAKRITAVLPYFGYARQDRKPGPRTPISAKLVANLI
THAGADRVMTLDLHAGQIQGFFDIPTDNLYSAPVMVRDIKERFDTSNVMVVSPDVGGVVR
ARALAKRIDAQLAIVDKRRERPGESEVMNVIGNVEGRSCILVDDIVDSGGTLVNAADALL
ARGAKEVTAYITHGVLSGGAVARVTASKLKELVITDSILPTEAVRVARNIRVVSIATLIG
EAIARTAHEESVSSLFD