Protein Info for GFF1933 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: DedA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details PF09335: VTT_dom" amino acids 49 to 176 (128 residues), 86.2 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 97% identical to DEDA_ECO57: Protein DedA (dedA) from Escherichia coli O157:H7

KEGG orthology group: K03975, membrane-associated protein (inferred from 97% identity to eco:b2317)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>GFF1933 DedA protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDLIYFIIDFILHIDVHLAELVAEYGVWVYAILFLILFCETGLVVTPFLPGDSLLFVAGA
LASLETNDLNVHVMVALMLIAAIVGDAVNYTIGRLFGEKLFSNPNSKIFRRSYLDKTHQF
YEKHGGKTIILARFVPIVRTFAPFVAGMGHMSYRHFAAYNVIGALLWVLLFTYAGYFFGT
IPLIQDNLKLLIVGIIVVSILPGVIEIVRHKRAASRAAK