Protein Info for GFF1932 in Sphingobium sp. HT1-2

Annotation: Alpha-1,2-mannosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 775 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01180: putative alpha-1,2-mannosidase" amino acids 12 to 757 (746 residues), 662.5 bits, see alignment E=3.5e-203 PF17678: Glyco_hydro_92N" amino acids 36 to 284 (249 residues), 218 bits, see alignment E=1.7e-68 PF07971: Glyco_hydro_92" amino acids 291 to 752 (462 residues), 573.8 bits, see alignment E=3.1e-176

Best Hits

KEGG orthology group: None (inferred from 70% identity to sjp:SJA_C1-30440)

Predicted SEED Role

"Alpha-1,2-mannosidase" in subsystem Mannose Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (775 amino acids)

>GFF1932 Alpha-1,2-mannosidase (Sphingobium sp. HT1-2)
MILTRIARPVLLAALLTGTALSAQTSEAPSAPVDAVDPFIGTSGEGHTFPGAVAPFGMVQ
LSPDTHVGPARQTYNWAAGYRHEDPVILGFSHTHFSGAGHSDLGDFLVMPVSGDSVPLEA
GDDKTPGFRSHKADEIASAGYYAVTLTDPGVRAEMTAGTRVGVHRYAFPTGKAAHLLLDL
RSIIYDYPGKILWSSIRIRPDGTITGSREVRGWATPRRIFFAIRFSAPLTGHRFVSTEKD
ILYKGFKGPGRGPETLDSLSGRALVAQLDFGTLAKPLEAKVALSGVDEDGAIANLASEPG
DFDAIRAKTRTAWNDALGAVKIDAPKAMRTNVYTALYHSLMAPSVWSDTDGRWRGPDDQV
HAGTGFTMHSTFSLWDTFRAEHPLLTLIQPEAKNADFVNSLVAGQKTSPFGILPVWQFGG
KETWTMIGYHAVPVIADACLKGIRGIDCAAALKAMVASADYAAYGGLGDYMKLGYVPIDR
EPEAASKTVEYAYDDWTIARLARQLGDTATAQRFEKRSQNWRNSFDAKTGFLRARKADGS
FRTPFDPTAINYGSDYTEGNAWQYSWFMPHDQGGLFRLLGGDAKTIAKLDAMFDYDNSKI
DYSHAEDISGLIGQYIHGNEPSHHVAYLYSYAGQPWRTQERLKQIVDSQYKPTPDGLAGN
DDLGQMSAWLVFTALGFYPVAPGSNQYVIGRPFVERAEMTLPSGQRFTMIAEGLSDANRY
VGQVTLNGKPLDRSYITDAEIRAGGELRFTMQANPNKTWATGVKARPFSMTGYGK