Protein Info for GFF1931 in Pseudomonas sp. DMC3

Annotation: NAD(P)H-dependent anabolic L-arginine dehydrogenase DauB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 70% identical to DAUB_PSEAE: NAD(P)H-dependent anabolic L-arginine dehydrogenase DauB (dauB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01750, ornithine cyclodeaminase [EC: 4.3.1.12] (inferred from 85% identity to pfo:Pfl01_0970)

MetaCyc: 70% identical to anabolic L-arginine dehydrogenase (Pseudomonas aeruginosa)
RXN-11194 [EC: 1.4.1.25]

Predicted SEED Role

"Ornithine cyclodeaminase (EC 4.3.1.12)" in subsystem Arginine and Ornithine Degradation (EC 4.3.1.12)

MetaCyc Pathways

L-ornithine degradation I (L-proline biosynthesis) (1/1 steps found)
D-arginine degradation (2/3 steps found)
L-arginine degradation VII (arginase 3 pathway) (1/2 steps found)
L-proline biosynthesis II (from arginine) (1/2 steps found)

KEGG Metabolic Maps

Arginine and proline metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.12

Use Curated BLAST to search for 1.4.1.25 or 4.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF1931 NAD(P)H-dependent anabolic L-arginine dehydrogenase DauB (Pseudomonas sp. DMC3)
MSSTPYVIVQAQAHELLARIDVPQILRKLFRDLAAGNAVQPAQQLVEFPQGAGDFINYLG
VLAEDGVYGVKTSPYIVREQGALVTAWTLLMSMKTGQPLLLCDAGELTTVRTAATTAVAV
DALAPLDAQRLAIIGSGKVAQAHLHYAKALRDWQSISLYSPSLLEDAETQTVLKSIAPSL
KIADSRETAISDADVIMLCTSSAGPVIDPEQLHKPALITSISTNAPRAHEVPPQSLNDMQ
VFCDYRLTTPGSAGEMLIAAEQHGWSKDSIVGDLADLLSEKVQRPGYDRHVFFRSIGLGL
EDIALANAVYHLTH