Protein Info for PS417_09830 in Pseudomonas simiae WCS417

Annotation: 6-carboxy-5,6,7,8-tetrahydropterin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 PF01242: PTPS" amino acids 2 to 118 (117 residues), 131.2 bits, see alignment E=1e-42 TIGR03367: queuosine biosynthesis protein QueD" amino acids 2 to 94 (93 residues), 112.7 bits, see alignment E=4.3e-37

Best Hits

Swiss-Prot: 76% identical to QUED_ECOLI: 6-carboxy-5,6,7,8-tetrahydropterin synthase (queD) from Escherichia coli (strain K12)

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 98% identity to pfo:Pfl01_3776)

MetaCyc: 76% identical to 6-carboxy-5,6,7,8-tetrahydropterin synthase (Escherichia coli K-12 substr. MG1655)
RXN0-5507 [EC: 4.1.2.50]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.50 or 4.2.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TY10 at UniProt or InterPro

Protein Sequence (118 amino acids)

>PS417_09830 6-carboxy-5,6,7,8-tetrahydropterin synthase (Pseudomonas simiae WCS417)
MEIFKEFTFESAHRLPHVPEGHKCGRLHGHSFKVAIHLSGDLDPHTGWIRDFSEIKAIFK
PLYERLDHNYLNDIPGLENPTSEVLAKWIWNELKPLLPELSAIRIHETCTSGCIYRGE