Protein Info for GFF1930 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Transcriptional regulatory protein zraR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 transmembrane" amino acids 134 to 151 (18 residues), see Phobius details PF13185: GAF_2" amino acids 39 to 180 (142 residues), 38.6 bits, see alignment E=5.7e-13 PF01590: GAF" amino acids 39 to 178 (140 residues), 49 bits, see alignment E=4.2e-16 PF00158: Sigma54_activat" amino acids 213 to 379 (167 residues), 241.7 bits, see alignment E=1.6e-75 PF14532: Sigma54_activ_2" amino acids 214 to 384 (171 residues), 67.5 bits, see alignment E=7.2e-22 PF00004: AAA" amino acids 237 to 368 (132 residues), 25 bits, see alignment E=1e-08 PF07728: AAA_5" amino acids 237 to 355 (119 residues), 27 bits, see alignment E=1.9e-09 PF25601: AAA_lid_14" amino acids 385 to 466 (82 residues), 80.7 bits, see alignment E=2.7e-26 PF02954: HTH_8" amino acids 484 to 517 (34 residues), 34.9 bits, see alignment (E = 4.5e-12)

Best Hits

KEGG orthology group: K02584, Nif-specific regulatory protein (inferred from 64% identity to mfa:Mfla_2176)

Predicted SEED Role

"Transcriptional regulatory protein zraR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (521 amino acids)

>GFF1930 Transcriptional regulatory protein zraR (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPSSPSDLDSPATDWHAQELLLMREVMKLVGRSLAPAFVLREMLHLMSELLGLNRGRMVL
ARETAPGEARTASVRHAYGLTAEEVQRGVFRWGEGITGRVLATGLPAIVQDVDAEPLFLF
RTVPRDRLPPQTVAFIALPIEVNGATIGVLACHRIRSRQRHLNDDLAVLRILATLAGQLL
RLEQLVAEQTRQLLARNAALARALDSASARYGLIGRSPALLQALGELEQVSQSQATVLLL
GESGTGKELFARAVHLASGRHDQPFIKVNCSAIPDTLFESELFGYEKGAFTGANTARAGW
FEQAHGGTIFLDEIGELPLAMQSKLLRTLQEGTLVRLGSTRELKVNVRLVAATNRDLAHE
VQAGRFRQDLYYRLNVIPIRLPSLRERGEDVRALALHFVNRANQAHQRNVNLAPDALARL
EAHDWPGNIRELGNLIERLVLLADHTLVTAATLERFMPQGTTAAASEAAPLVRDYQSAQS
HSAQALREALARHQGNQSRAAQSLGLTLRQFAYRLRKAGLR