Protein Info for GFF1929 in Pseudomonas sp. DMC3

Annotation: Transcriptional regulator DauR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF08348: PAS_6" amino acids 10 to 115 (106 residues), 91.5 bits, see alignment E=3.3e-30 PF13309: HTH_22" amino acids 143 to 204 (62 residues), 63.6 bits, see alignment E=1.4e-21

Best Hits

Swiss-Prot: 87% identical to DAUR_PSEAE: Transcriptional regulator DauR (dauR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 93% identity to pfo:Pfl01_0968)

Predicted SEED Role

"YheO-like PAS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>GFF1929 Transcriptional regulator DauR (Pseudomonas sp. DMC3)
MTAPEFDPALDNFRAIADAIATLFFPHAEVVLHDLRTQKVDYIANNLSKREIGDDSSLED
MLSEDVSDRNIGPYEKLNWDGQKIRSLSTVLRDSEGRPLAVLCINLNISLFENAKAALDL
FLSPSKLIPQPDSLFRDDWQERINTFLHAWLRERQLSLNLLTRDHKRELVLALHAEGAFK
GKSASNYVANVLNMGRATVYKHLKELKG