Protein Info for GFF1928 in Variovorax sp. SCN45

Annotation: Fumarylacetoacetate hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 28 to 229 (202 residues), 193.5 bits, E=1.9e-61

Best Hits

Swiss-Prot: 43% identical to Y643_PYRHO: Uncharacterized protein PH0643 (PH0643) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: None (inferred from 69% identity to pnu:Pnuc_1321)

MetaCyc: 55% identical to 3-fumarylpyruvate hydrolase (Bradyrhizobium sp. JS329)
RXN-10445 [EC: 3.7.1.20]

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

• gentisate degradation I (2/3 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• 5-nitroanthranilate degradation (2/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.20

Protein Sequence (229 amino acids)

>GFF1928 Fumarylacetoacetate hydrolase family protein (Variovorax sp. SCN45)
MTSYAISPAPVHSLPIQGESARFPVNRIFCVGRNYSEHAREMGHNPDREPPFFFMKPANA
IVADGGEFAYPTLSNDVHHEIELVVALKTGGSNIAASDALSHVYGYAVGLDMTRRDLQSE
AKKMGRPWDTGKAFDGSAPCGELVPVAKAGHPAAGEIRLEVNGAQRQVGDLGDMIWNVPD
TIAYLSTLFTLQPGDLIFTGTPAGVAAVQRGDRMRGTVAGVGALEVVVV