Protein Info for PS417_09730 in Pseudomonas simiae WCS417
Annotation: adenylylsulfate kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 56% identical to CYSC_PSEAE: Adenylyl-sulfate kinase (cysC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 89% identity to pfs:PFLU2097)MetaCyc: 57% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]
Predicted SEED Role
"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)
MetaCyc Pathways
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
- superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
- assimilatory sulfate reduction I (4/4 steps found)
- sulfate activation for sulfonation (2/2 steps found)
- assimilatory sulfate reduction IV (3/4 steps found)
- superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.7.1.25
Use Curated BLAST to search for 2.7.1.25
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U4K6 at UniProt or InterPro
Protein Sequence (204 amino acids)
>PS417_09730 adenylylsulfate kinase (Pseudomonas simiae WCS417) MSYFPDTSNQNLHAFAFSRRRAGHPSMKHKPVVIWMTGLSASGKSTIADALDIALQEQGR ITAIIDGDSVRGGLCRDLGFTDSDRDENIRRVAEVARLMLEAGLIVIVALISPSSASRHF ARSIIGNEFFVEVHVDAPLETAEKRDPKGLYKKARAGLIKNFTGIDSRYDVPVFPEVHLD TQALSVEQSVATILDWVAHNDGCT