Protein Info for PS417_09730 in Pseudomonas simiae WCS417

Annotation: adenylylsulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 26 to 196 (171 residues), 223.2 bits, E=1e-70
• PF01583: APS_kinase
  • amino acids 30 to 184 (155 residues), 213.6 bits, E=2.2e-67
• PF13671: AAA_33
  • amino acids 33 to 145 (113 residues), 29.1 bits, E=1.7e-10
• PF08433: KTI12
  • amino acids 34 to 108 (75 residues), 25.3 bits, E=1.6e-09

Best Hits

Swiss-Prot: 56% identical to CYSC_PSEAE: Adenylyl-sulfate kinase (cysC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 89% identity to pfs:PFLU2097)

MetaCyc: 57% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.25

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

See A0A1N7U4K6 at UniProt or InterPro

Protein Sequence (204 amino acids)

>PS417_09730 adenylylsulfate kinase (Pseudomonas simiae WCS417)
MSYFPDTSNQNLHAFAFSRRRAGHPSMKHKPVVIWMTGLSASGKSTIADALDIALQEQGR
ITAIIDGDSVRGGLCRDLGFTDSDRDENIRRVAEVARLMLEAGLIVIVALISPSSASRHF
ARSIIGNEFFVEVHVDAPLETAEKRDPKGLYKKARAGLIKNFTGIDSRYDVPVFPEVHLD
TQALSVEQSVATILDWVAHNDGCT