Protein Info for GFF1908 in Variovorax sp. SCN45

Annotation: Short-chain dehydrogenases of various substrate specificities

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF08659: KR" amino acids 7 to 171 (165 residues), 43.2 bits, see alignment E=8.7e-15 PF00106: adh_short" amino acids 8 to 192 (185 residues), 150.2 bits, see alignment E=1e-47 PF01370: Epimerase" amino acids 9 to 134 (126 residues), 25.5 bits, see alignment E=1.7e-09 PF13561: adh_short_C2" amino acids 13 to 192 (180 residues), 104.1 bits, see alignment E=1.8e-33

Best Hits

KEGG orthology group: K07124, (no description) (inferred from 80% identity to vpe:Varpa_4487)

Predicted SEED Role

"Short-chain dehydrogenases of various substrate specificities"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>GFF1908 Short-chain dehydrogenases of various substrate specificities (Variovorax sp. SCN45)
MTTNLKGTALITGASSGIGAVYADRLARRGFDLILVARNGERLRKLADRLAGETGRKVDT
LVADLTDRQDIARVEAVLRADSAITVLVNNAGVGATAPLLASDIDKMDEMIALNVNVLTR
LTYAAVPGFVARGAGTLINIASVVALSPETLNGVYGGSKAFVLALSHSLQHELAGKGVRV
QAVLPGATATEFWGIAGLPVQHLPSEIVMTAEDMVDAALAGLDQGERVTIPALPDLAEWD
AFEAARRAMSGRLSSTLPAQRYRAAAVSA