Protein Info for GFF1906 in Sphingobium sp. HT1-2

Annotation: D-beta-hydroxybutyrate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 92 to 134 (43 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 179 to 202 (24 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 377 to 405 (29 residues), see Phobius details amino acids 426 to 449 (24 residues), see Phobius details amino acids 461 to 483 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 64% identity to azc:AZC_1305)

Predicted SEED Role

"D-beta-hydroxybutyrate permease" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (486 amino acids)

>GFF1906 D-beta-hydroxybutyrate permease (Sphingobium sp. HT1-2)
MSEALSFLGILVALGALIAMAYRGWSVLFLAPTLAMIAASFSGYPMLASWTQIFMVAAAG
FLAQFFPLFLLGAIFAKLMNDSGSVRAIADAMIGWLGSGRAIMAVVLAGAILTYGGVSLF
VAFFVLVPMAQALFRAGNIPRRLVPATIILGTSTFTMTALPGTPAIQNVIPMPFFGTSIY
AAPGLGLIAAVIMLAVGLGWLLRAQAAAAARQEGYDPSLSPVAPVDSARMREHTTTASTF
DPAEMDKGAPTDDRPSLGIAFLPIGVMIGCNLILSLWLFPTWDAPFLAEPLWGSTSLGAV
AGIWSVTAALMIATLAIILCNRGRLVSLRDSIDSGANAAVLPIISVASLVGFGAVIAALP
AFHMIRDWVLGMGGGPLVSLAVATNLLAALTGSASGGLTIALEALGPTYMDIAARTGTDP
AIMHRVAVIGSGTLDILPHNGAIVTLLALSGVTHRESYLDIAMAGIVSSLAALVAVILIG
SMIGSF