Protein Info for GFF1905 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details PF01925: TauE" amino acids 9 to 241 (233 residues), 68 bits, see alignment E=5.3e-23

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 61% identity to mpt:Mpe_A2576)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>GFF1905 membrane protein, putative (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDLLLLGLIAAVFLAAGAVKGISGMGLPTFSVALLGLFMPTATAATLMLLPSLLTNIAQC
IGPHARTLAHRLWPMWLMLAAATVWSPLPDLGSAGPGARLTLGTVLVVYGLWGLTRAALP
EPGRLARPLGGVAGALSGLLTAATGVFVMPMVPYLQSLRLEKDVMIQALGLSFLVATLAL
AVRLGPLAVLSGAAVPLTGHAVALAAAFAGLWFGSVLRRRLPLPVFQRALYSVFIALGAL
MLARAL