Protein Info for GFF19 in Pseudomonas sp. DMC3

Annotation: Esterase EstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 635 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00657: Lipase_GDSL" amino acids 33 to 315 (283 residues), 48.7 bits, see alignment E=1.7e-16 PF03797: Autotransporter" amino acids 365 to 615 (251 residues), 166.1 bits, see alignment E=1.9e-52

Best Hits

Swiss-Prot: 65% identical to ESTA_PSEPU: Esterase EstA (estA) from Pseudomonas putida

KEGG orthology group: K12686, outer membrane lipase/esterase (inferred from 83% identity to pba:PSEBR_a5120)

Predicted SEED Role

"Phospholipase/lecithinase/hemolysin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (635 amino acids)

>GFF19 Esterase EstA (Pseudomonas sp. DMC3)
MIRQTLFVPLASCLLALACAQANAAPNPYSSFIVFGDSLNDAGTFADTGGPAGSTERYTN
RTGPVYQDGSGEVFSLNSTQLLGGRLGFSPDQTASSSSAVRAENGQPDGNNWAVGGYRTD
QILDSITTQSATGERTRAGYLPSNGFRADPNALYYISGGGNDFLQGRILSLPQANAAADR
LADSVQTLQTAGAKYVMVWLLPDVGLTPALNGTPLQAFSSTLANQFNSQLVTRLQGINAE
VIPLNIPVLLSEVFADPGRFGLATDQNLTATCFSGNSCTENARYGINSATPDPTKLIYND
GVHPTESGQKLIADYAYSLLAAPWELSLLPEMAHGTVRAHQDELRNQWQADWENWQAVGQ
WRAIVSAGGQHLDVDSQSSGASADGSGYNLNVGGSYRLNEAWRVGVAAGFYRQNLEAGHN
DSDYKLNSYMATAFAQFQQNRWWADAALTGGKLDYDNLKRKFDLGASEGAEKGDTDGSLW
AFSTRLGYDIAQPGSQWHLSPFVSADYASVDVDGYSEKSNRATALTFDDQSRDSKRLGLG
IQGKYNFTAQTQVYGEYAHEREYEDDVQKVNIALNTLPANDFTLEGYTPASHLNRLSLGV
SHKLTADLALRGGYTFRKDDDFKQQGLNVGVVLDF