Protein Info for GFF1899 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: L-threonine 3-dehydrogenase (EC 1.1.1.103)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF08240: ADH_N" amino acids 25 to 136 (112 residues), 106 bits, see alignment E=1.4e-34 PF16912: Glu_dehyd_C" amino acids 145 to 338 (194 residues), 61.7 bits, see alignment E=1.1e-20 PF00107: ADH_zinc_N" amino acids 177 to 305 (129 residues), 61.3 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: K00060, threonine 3-dehydrogenase [EC: 1.1.1.103] (inferred from 72% identity to dac:Daci_4519)

Predicted SEED Role

"L-threonine 3-dehydrogenase (EC 1.1.1.103)" in subsystem Glycine Biosynthesis or Threonine degradation (EC 1.1.1.103)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.103

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>GFF1899 L-threonine 3-dehydrogenase (EC 1.1.1.103) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKSLQKPSPAPGLELRDAAVPTPGPGEVLLRVKATGVCGTDLHIDEWTSSYHFMTRALPV
TIGHEFSGEVSACGEGVSGLRPGQLVTVRPSVVCGVCAACQAQDFDTCTTRQGIGVMRHG
AFADWVVAPARNCVPVPAGVDPLVAALAEPLSVSLEAVRTGGVKRGDRVLVLGPGNIGQG
IALFAREAGASQVVVAGHGDAPRMAVLQRLGFNDLIDVAQGGMAQGLAPYLAAGRFDVVI
EATGAAAVIAPALQALKPHGVLVITGIHAAPVPIDLTALVRQHQTLRGSYRAPEAAWPEV
VAFMERHQDLLRHMITHRVPLSEAAQGFALARDRVATKVMVLPDGEWTPA