Protein Info for GFF1897 in Variovorax sp. SCN45

Annotation: Two-component system sensor histidine kinase/response regulator hybrid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 724 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 364 to 485 (122 residues), 80.2 bits, see alignment E=7.3e-27 PF00989: PAS" amino acids 366 to 475 (110 residues), 51.2 bits, see alignment E=4.1e-17 PF13188: PAS_8" amino acids 372 to 415 (44 residues), 27.9 bits, see alignment 5.7e-10 PF08448: PAS_4" amino acids 382 to 483 (102 residues), 44.6 bits, see alignment E=5.6e-15 PF13426: PAS_9" amino acids 382 to 480 (99 residues), 45.1 bits, see alignment E=3.6e-15 PF08447: PAS_3" amino acids 388 to 471 (84 residues), 35.5 bits, see alignment E=3.4e-12 PF02518: HATPase_c" amino acids 613 to 720 (108 residues), 83.5 bits, see alignment E=5.1e-27

Best Hits

KEGG orthology group: None (inferred from 84% identity to vap:Vapar_3943)

Predicted SEED Role

"C4-dicarboxylate transport sensor protein dctS (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (724 amino acids)

>GFF1897 Two-component system sensor histidine kinase/response regulator hybrid (Variovorax sp. SCN45)
MPPTSLEPPVPPFRPRLRYRTVAAWTAACAFALLLIGLAGQWAAVREANFQADSIRRAME
VHVLGLRDSAGKYSYLPFTTGLHPEVLAALAHPEDAAVKQRANLYIEEVNRQAGSDALYL
SDLQGLTLAASNWDTPQSFVGESYANRPYFRDARAGRSGLFYGLGQTTGEPGLFISAPVR
PDGGAVLGVVTVKVSLRQLQEAWTFVRDPILLTDARGIVFLSSVPSWMYQATRALSPTDV
EGIRRDQQYGARTDFPPLPWQLERDDGQPGYLVRTSIGGKPRRFLAVDEPLPDLGWTLTV
MADHAEVSRARERTWMLGLLVAGVLLLGGLYWQLRERRFAEQRDARRDLELRVRERTHAL
DEAHAFRKAMEDSLLVGMRARDLEGRITYVNPAFCDMTGYGADELLGRLPPYPYWHPDDV
TQHWHHYDAMMSGQPARSGFESRLRHRDGREVITMVYTARLIDADGRHSGWMSSVVDITE
QKRAELRQRQNDEQLQHAQRLASLGEMASTLAHELNQPLMALSNFASAAKAFAEQGNQAL
LVSSLDETMAQAQRSAEIVRRIRGFVRQRTVGTEDCAVPALVTNVLALLQGEMRQRQVRA
EVRVPANLPPVRGDRVLLEQVLLNLLSNSLQAMQSTPQEKRVVEIDAEALDGRMRIRIAD
RGAGIDASLAEQVFAPFFTTKAGGLGLGLNICRTIVEAHRGRLSFADRPGGGTVFTLALE
ISPP