Protein Info for GFF1896 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 46 (18 residues), see Phobius details amino acids 57 to 84 (28 residues), see Phobius details amino acids 95 to 123 (29 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 418 to 448 (31 residues), see Phobius details amino acids 462 to 481 (20 residues), see Phobius details amino acids 503 to 533 (31 residues), see Phobius details amino acids 545 to 566 (22 residues), see Phobius details amino acids 586 to 606 (21 residues), see Phobius details PF03600: CitMHS" amino acids 16 to 542 (527 residues), 284.1 bits, see alignment E=3e-88 amino acids 504 to 605 (102 residues), 54.8 bits, see alignment E=1.7e-18 PF02080: TrkA_C" amino acids 230 to 295 (66 residues), 35.9 bits, see alignment E=1.2e-12 amino acids 324 to 387 (64 residues), 42.5 bits, see alignment E=1e-14 PF06808: DctM" amino acids 416 to 602 (187 residues), 32 bits, see alignment E=1.3e-11 PF00939: Na_sulph_symp" amino acids 435 to 602 (168 residues), 48.6 bits, see alignment E=1.3e-16

Best Hits

Swiss-Prot: 91% identical to YFBS_ECOLI: Uncharacterized transporter YfbS (yfbS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to cko:CKO_00503)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (608 amino acids)

>GFF1896 Putative transport protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VNGELIWVLSLLAIAVVLFATGKVRMDAVALFVIVAFVLSGTLTLPEAFSGFSDPNVILI
AALFIIGDGLVRTGVATVVGTWLVKMAGSSEIKMLVLLMITVAGLGAFMSSTGVVAIFIP
VVLSVSMHMQTSPSRLMMPLSFAGLISGMMTLVATPPNLVVNSELLREGLHGFNFFSVTP
LGVVVLALGIVYMLVMRFMLKGDAPGQQAGKRRTFRDLIREYRLTGRARRLAIRPGSPMV
GQRLDDLKLRERYGANVIGVERWRRFRRVIVNVNGVSEFRARDVLLIDMSAAEVDLREFC
AEQLLEPMVLRGEYFSDQALDVGMAEISLIPESELIGKSVREIAFRTRYGLNVVGLKRDG
VALEGSLADEPLLMGDIILVVGNWKLISLLGQKGRDFVVLNMPVEVSEASPAHSQAPHAI
FCLVLMVALMLTDEIPNPIAAIIACLLMGKFRCIDAESAYKAIHWPSIILIVGMMPFALA
LQKTGGVSLVVQGLMDIGGGYGPYMMLGCLFVLCAVIGLFISNTATAVLMAPIALAAAKS
MGVSPYPFAMAVAMAASAAFMTPVSSPVNTLVLGPGNYSFSDFVKLGVPFTLIVMAVCIV
MIPMLFPF