Protein Info for GFF1891 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG011065: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 136 to 164 (29 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF01925: TauE" amino acids 8 to 244 (237 residues), 171 bits, see alignment E=1.8e-54

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 80% identity to pna:Pnap_0177)

Predicted SEED Role

"FIG011065: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>GFF1891 FIG011065: hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MELILVSLASLFAGFVDSIVGGGGLILVPALFAMFPTTHPATLFGVNKGASVWGTAAATL
QYARRVEMPWHALLPAAAVGFAGSMAGAWTVTVISPDFLRRALPLVLLLVLGYTLARKEL
GRHHTPRFSGRREMLAASLLGGVIGFYDGFFGPGTGSFFVFLFVRWLGYDFLHASASAKL
LNTATNLAALMLFAWKGHVWWHFVLAMAIANVVGSLLGTRLALKHGSGFVRIVFIFVVSA
LILKTTYDAWLRG