Protein Info for GFF1889 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Rod shape-determining protein MreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 46 to 73 (28 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 104 to 104 (1 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details PF04093: MreD" amino acids 15 to 128 (114 residues), 47 bits, see alignment E=1.6e-16 TIGR03426: rod shape-determining protein MreD" amino acids 15 to 161 (147 residues), 86.4 bits, see alignment E=1e-28

Best Hits

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 72% identity to rfr:Rfer_3921)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>GFF1889 Rod shape-determining protein MreD (Hydrogenophaga sp. GW460-11-11-14-LB1)
MIMRPGQQLLLPANPGFIWFSLLAALVFNMLLNMGLFGRAAWVPDLLAVVLVFWSVHQPL
RIGVGVAFAFGLAMDVHQGALLGQHALAYTALGFLGISMHRRLLWFSVPNQAVQVLPLFV
AAHLLEMLARLAGGGSFPGLTYFLAPLIEAALWPVVSVLLLAPQRRAPNPDDNRPL