Protein Info for PS417_09595 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 187 to 204 (18 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 250 to 280 (31 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 368 to 386 (19 residues), see Phobius details amino acids 406 to 424 (19 residues), see Phobius details amino acids 430 to 447 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 255 to 382 (128 residues), 46.2 bits, see alignment E=2.1e-16

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU2073)

Predicted SEED Role

"Extracellular Matrix protein PslJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UIY7 at UniProt or InterPro

Protein Sequence (475 amino acids)

>PS417_09595 membrane protein (Pseudomonas simiae WCS417)
MNLPSLVAILFGLLFGAAALLLSPAKAFLAVIGLAGAVTILRFPFWGLLLFALVATFMPY
STVNLGIRSTVSEAILAMTWGAVLWQNFLVRLPDTPSLTRRPTDQMLLWLMVFSVFPFIV
GQVTIHADSSGVANWLRWLLNLSGVFLCAKLLVDHKHRESLVIALLLGSLAMLMLSIAVF
VRTRSGAGIAPVLALFNYGNFDMLKFGLEAMSSRMGSPWMHPNAIGGIMALLLPLAFCFG
MTEQGWKRALGLGVACLGAAALLLASSRGAMVSLALVLLWMATRRVPYTGRLLMIGAALT
AVLVMAYPPLQERLATIFSSSNASTEVRFDEYRMFPQAMVSYPFGIGFKVDPPVPGTPLL
GISNLWLNYIYKTGIVGMLFFIAVTVRWWREARPESGPIRLTKDNALWLGTTAGILSALV
SGLFDHYFSFAVVMVALFWLMVGINVLEARRLFPARLPQVKRVVFGKPVLDGAQP