Protein Info for GFF1884 in Variovorax sp. SCN45

Annotation: Gluconokinase (EC 2.7.1.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF00005: ABC_tran" amino acids 5 to 58 (54 residues), 25.7 bits, see alignment E=2.4e-09 PF13671: AAA_33" amino acids 10 to 140 (131 residues), 30.1 bits, see alignment E=8.6e-11 TIGR01313: carbohydrate kinase, thermoresistant glucokinase family" amino acids 11 to 165 (155 residues), 192.2 bits, see alignment E=2.7e-61 PF01202: SKI" amino acids 18 to 125 (108 residues), 30.5 bits, see alignment E=5.7e-11

Best Hits

Swiss-Prot: 55% identical to GCNK_GLUOX: Gluconokinase (GOX1709) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 55% identity to aau:AAur_2721)

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.12, 2.7.1.71

Use Curated BLAST to search for 2.7.1.12 or 2.7.1.71

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>GFF1884 Gluconokinase (EC 2.7.1.12) (Variovorax sp. SCN45)
MPLSSEKPQVLVLMGVSGCGKTTVAAILAGRLSWPFEEGDALHPPSNIAKMEAGHPLTDE
DRAPWLRKVADWVDERIDAGENGLITCSALKRSYREVINRRGAGVVFVYLHGSRETIAAR
LMARHGHFMPPSLLDSQFADLEEPSADEPSIRVDIGPAPSALAQTIIDSLGLK