Protein Info for GFF1884 in Pseudomonas sp. DMC3

Annotation: L-serine dehydratase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00720: L-serine ammonia-lyase
  • amino acids 3 to 454 (452 residues), 703.6 bits, E=5.8e-216
• PF03315: SDH_beta
  • amino acids 4 to 155 (152 residues), 201.6 bits, E=8.9e-64
• PF03313: SDH_alpha
  • amino acids 186 to 452 (267 residues), 312.3 bits, E=3.2e-97

Best Hits

Swiss-Prot: 54% identical to TDCG_ECOLI: L-serine dehydratase TdcG (tdcG) from Escherichia coli (strain K12)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 95% identity to pfo:Pfl01_0920)

MetaCyc: 54% identical to L-serine deaminase III (Escherichia coli K-12 substr. MG1655)
L-serine ammonia-lyase. [EC: 4.3.1.17]

Predicted SEED Role

"L-serine dehydratase (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• glycine betaine degradation III (7/7 steps found)
• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• glycine betaine degradation I (6/8 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17

Use Curated BLAST to search for 4.3.1.17

Protein Sequence (458 amino acids)

>GFF1884 L-serine dehydratase 2 (Pseudomonas sp. DMC3)
MAISVFDLFKVGIGPSSSHTVGPMRAAATFAQALVDQHLLNDVRRVQIRLYGSLSATGVG
HATDRATVMGLMGEWPDSIDPSTIDPRIQQLRETGQLSLAGQRSIAFDWQSDLLLLDESL
PYHPNAMSLSAFGASAELFTQTYYSVGGGFIVEAAEAESGVAPISDVVLPYDFSSAAELL
ALCKQHNLRVSELMMANERAWRSDAEIRQGLLHIWSVMRECVEQGLRHEGILPGGLKVPR
RAAKLHRSLLEIGKPNVISSTLSAMEWVNLFALAVNEENAAGGRMVTAPTNGAAGIIPAV
LHYYMKFNPDASDDDVVAFFLAAAAVGILCKKNASISGAEVGCQGEVGSACAMAAAGLAD
VLGATPEQLENAAEIGLEHNLGLTCDPVGGLVQVPCIERNAIAAVKAINATQMALRGDGN
HFISLDRVIRTMRDTGADMHDKYKETSRGGLAVNWVEC