Protein Info for PS417_09585 in Pseudomonas simiae WCS417

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 10 to 27 (18 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 7 to 322 (316 residues), 125 bits, see alignment E=1.8e-40

Best Hits

KEGG orthology group: None (inferred from 85% identity to pfs:PFLU2071)

Predicted SEED Role

"Extracellular Matrix protein PslL"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U018 at UniProt or InterPro

Protein Sequence (348 amino acids)

>PS417_09585 acetyltransferase (Pseudomonas simiae WCS417)
MKHRWIQMDIAKGIGILVIVFAHSWFVATSPDLLYPVLASFILPLFFFLSGVFFKPEQPF
VEMAVRKADGLLKPFFFTMLIYVIVRSLLRGQPLLPDIGGVLYASVDTIPWQALWFLPHF
WVAILFSWLMLRLIQRLKLSLLLSCALVTLQLIVGVWMLPWFWQLPVTLGGHTWVLPGLP
FSLDITLISSTYFIVGYLLRDWLRAHSGSWLTLVVSVALFIAVFTFTWDTMDLAQRRYDH
WLWTTLPAVIGVYACWALAKVLMVSTWVTRAMTYIGQNTLILLIFHGEIQHKTFDLMERL
GLHAFAAACIGFVVAVVAPLLIGEVIKRVAFLRFFYFPFPVRKPQKTL