Protein Info for GFF1881 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 62 to 79 (18 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 114 to 130 (17 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 212 to 229 (18 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 372 to 395 (24 residues), see Phobius details amino acids 410 to 432 (23 residues), see Phobius details amino acids 453 to 473 (21 residues), see Phobius details amino acids 493 to 511 (19 residues), see Phobius details amino acids 542 to 543 (2 residues), see Phobius details amino acids 589 to 610 (22 residues), see Phobius details TIGR01974: proton-translocating NADH-quinone oxidoreductase, chain L" amino acids 2 to 608 (607 residues), 788.1 bits, see alignment E=4.2e-241 PF00662: Proton_antipo_N" amino acids 65 to 115 (51 residues), 73.8 bits, see alignment 8.5e-25 PF00361: Proton_antipo_M" amino acids 131 to 423 (293 residues), 328.3 bits, see alignment E=4.3e-102

Best Hits

Swiss-Prot: 95% identical to NUOL_ECOLI: NADH-quinone oxidoreductase subunit L (nuoL) from Escherichia coli (strain K12)

KEGG orthology group: K00341, NADH dehydrogenase I subunit L [EC: 1.6.5.3] (inferred from 97% identity to cko:CKO_00518)

MetaCyc: 95% identical to NADH:quinone oxidoreductase subunit L (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (611 amino acids)

>GFF1881 NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLALTIILPLIGFVLLAFSRGRWSENLSATIGVGSVGLAALVTAFVGMDFFANGKQAFSQ
PLWTWMSVGNFNIGFNLVLDGLSLTMLSVVTGVGFLIHMFASWYMRGEEGYSRFFAYTNL
FIASMVVLVLSDNLLLMYLGWEGVGLCSYLLIGFYYSDPKNGAAAMKAFVVTRVGDVFLA
FALFILYNELGTLNFREMVELAPAHFADGNNMLMWATLMLLGGAVGKSAQLPLQTWLADA
MAGPTPVSALIHAATMVTAGVYLIARTHGLFLMTPEILHLVGIIGAITLVMAGFAALVQT
DIKRVLAYSTMSQIGYMFLALGVQAWDAAIFHLMTHAFFKALLFLASGSVILACHHEQNI
FKMGGLRKSIPLVYACFLVGGAALSALPLVTAGFFSKDEILAGAMANGHINLMVAGLVGA
FMTSLYTFRMIFIVFHGKEQIHAHAGKGITHHLPLIVLMILSTFVGALIVPPLQGVLPQT
TELAHGRVMTLEITSGVVAIAGILIAAWLWLGKRTLVTSIANSAPGRLLGTWWYNAWGFD
WLYDKVFVKPFLGIAWLLKRDPLNALMNIPAILSRFAGKGLVLSENGYLRWYVASMSIGA
VVVLALLMVLR